| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336889.1 | internal | 213 | 3-641(+) |
Amino Acid sequence : | |||
| LLNIIKDGVIELLSDEAEGLKFKLSDTVHIGPDGTLYFTDTSYKYAVHDSVIHIMEGRPHSTFLTYNPATKQTHVLVRDLYFANGVTVSANQTFLIFCETPMVRCQKYYVQGPLVGTVGM FFENLPGLPDNITYNGNGLYWIAIATESKFIIFLLRYPWIRKVVGVMDKYKRRPKTDRNGGAFCVDLDGKPDAHYYDPKISFATICNKIGDYL | |||
Physicochemical properties | |||
| Number of amino acids: | 213 | ||
| Molecular weight: | 24,138.498 | ||
| Theoretical pI: | 7.151 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31860 32110 | ||
| Instability index: | 27.050 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.081 | ||
Secondary Structure Fraction | |||
| Helix | 0.371 | ||
| turn | 0.216 | ||
| sheet | 0.188 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336889.1 | internal | 213 | 3-641(+) |
Amino Acid sequence : | |||
| LLNIIKDGVIELLSDEAEGLKFKLSDTVHIGPDGTLYFTDTSYKYAVHDSVIHIMEGRPHSTFLTYNPATKQTHVLVRDLYFANGVTVSANQTFLIFCETPMVRCQKYYVQGPLVGTVGM FFENLPGLPDNITYNGNGLYWIAIATESKFIIFLLRYPWIRKVVGVMDKYKRRPKTDRNGGAFCVDLDGKPDAHYYDPKISFATICNKIGDYL | |||
Physicochemical properties | |||
| Number of amino acids: | 213 | ||
| Molecular weight: | 24,138.498 | ||
| Theoretical pI: | 7.151 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31860 32110 | ||
| Instability index: | 27.050 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.081 | ||
Secondary Structure Fraction | |||
| Helix | 0.371 | ||
| turn | 0.216 | ||
| sheet | 0.188 | ||