| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336901.1 | 5prime_partial | 166 | 700-200(-) |
Amino Acid sequence : | |||
| GESIRSIRQGPVRPAMVDELSPRVLAGGAHRHVQRVEMLRPGVRHLRVRRLLLIPIHILIHPFLQRLPDPPVKLVRPLRHLVAAVAVDLPQIVRGGAGSEYQDAVLLQRPQRLSETVVVR GVLVGLHRQLDHRNVGVRIHQHERHPRAVVQPARVVHVDGFESGFV* | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 18,677.696 | ||
| Theoretical pI: | 11.781 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 54.696 | ||
| aromaticity | 0.024 | ||
| GRAVY | -0.079 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.205 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336901.1 | 5prime_partial | 166 | 700-200(-) |
Amino Acid sequence : | |||
| GESIRSIRQGPVRPAMVDELSPRVLAGGAHRHVQRVEMLRPGVRHLRVRRLLLIPIHILIHPFLQRLPDPPVKLVRPLRHLVAAVAVDLPQIVRGGAGSEYQDAVLLQRPQRLSETVVVR GVLVGLHRQLDHRNVGVRIHQHERHPRAVVQPARVVHVDGFESGFV* | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 18,677.696 | ||
| Theoretical pI: | 11.781 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 54.696 | ||
| aromaticity | 0.024 | ||
| GRAVY | -0.079 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.205 | ||
| sheet | 0.235 | ||