| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336908.1 | internal | 211 | 3-635(+) |
Amino Acid sequence : | |||
| TRNPELIPGVRKVSRSKMYHPRGLWAIKAKNGGEFPVHSKKDVAAAVEEKAPKIYPADDVKKPLSNTRKHKPTKLRASITPGTVLIILTGRFKGKRVVFLKQLTWGLLLVTGPYKVNGVP LMRVNQAYVIGTSRKVDISGVDVSKYDDKYFAKQVDKMKKKEEAEFFTSDNAEKKNNLPAEKMDDQKAVYGPLLQVIKCVPKLKAYLGARF | |||
Physicochemical properties | |||
| Number of amino acids: | 211 | ||
| Molecular weight: | 23,680.553 | ||
| Theoretical pI: | 10.042 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
| Instability index: | 23.730 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.483 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.213 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336908.1 | internal | 211 | 3-635(+) |
Amino Acid sequence : | |||
| TRNPELIPGVRKVSRSKMYHPRGLWAIKAKNGGEFPVHSKKDVAAAVEEKAPKIYPADDVKKPLSNTRKHKPTKLRASITPGTVLIILTGRFKGKRVVFLKQLTWGLLLVTGPYKVNGVP LMRVNQAYVIGTSRKVDISGVDVSKYDDKYFAKQVDKMKKKEEAEFFTSDNAEKKNNLPAEKMDDQKAVYGPLLQVIKCVPKLKAYLGARF | |||
Physicochemical properties | |||
| Number of amino acids: | 211 | ||
| Molecular weight: | 23,680.553 | ||
| Theoretical pI: | 10.042 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
| Instability index: | 23.730 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.483 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.213 | ||
| sheet | 0.218 | ||