| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336915.1 | complete | 111 | 494-159(-) |
Amino Acid sequence : | |||
| MSGFNTYRIINFIPNRCPFHKHRVSDRQHNLMWHGGIFNLVEQFFLQNISLFKRFSNLEFPHCYKFIKVHNVIVRPHVEDLVQGPRIIHWFNGVLCYILFLNKYCLCATIS* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 13,338.518 | ||
| Theoretical pI: | 9.504 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17210 | ||
| Instability index: | 39.306 | ||
| aromaticity | 0.162 | ||
| GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
| Helix | 0.423 | ||
| turn | 0.225 | ||
| sheet | 0.144 | ||