Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336915.1 | complete | 111 | 494-159(-) |
Amino Acid sequence : | |||
MSGFNTYRIINFIPNRCPFHKHRVSDRQHNLMWHGGIFNLVEQFFLQNISLFKRFSNLEFPHCYKFIKVHNVIVRPHVEDLVQGPRIIHWFNGVLCYILFLNKYCLCATIS* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 13,338.518 | ||
Theoretical pI: | 9.504 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17210 | ||
Instability index: | 39.306 | ||
aromaticity | 0.162 | ||
GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
Helix | 0.423 | ||
turn | 0.225 | ||
sheet | 0.144 |