| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336940.1 | complete | 159 | 285-764(+) |
Amino Acid sequence : | |||
| MLGAAPPRYNWTGGEIGSSTYFSMAPGNACVPAMEMTKWFDTNYHFIVPELGPDVKFSYSSHKAVNEYKEAKALGVDTVPVLLGPVTNLLLSKPAKGVEKTFPLLSLLDRILPIYKEVIA ELKATGASWIQWDEPTLVLDLEPYQLDAFTKAYAELESS* | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 17,544.956 | ||
| Theoretical pI: | 4.886 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 33920 | ||
| Instability index: | 29.416 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.029 | ||
Secondary Structure Fraction | |||
| Helix | 0.340 | ||
| turn | 0.245 | ||
| sheet | 0.314 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336940.1 | complete | 159 | 285-764(+) |
Amino Acid sequence : | |||
| MLGAAPPRYNWTGGEIGSSTYFSMAPGNACVPAMEMTKWFDTNYHFIVPELGPDVKFSYSSHKAVNEYKEAKALGVDTVPVLLGPVTNLLLSKPAKGVEKTFPLLSLLDRILPIYKEVIA ELKATGASWIQWDEPTLVLDLEPYQLDAFTKAYAELESS* | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 17,544.956 | ||
| Theoretical pI: | 4.886 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 33920 | ||
| Instability index: | 29.416 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.029 | ||
Secondary Structure Fraction | |||
| Helix | 0.340 | ||
| turn | 0.245 | ||
| sheet | 0.314 | ||