| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336942.1 | internal | 259 | 1-777(+) |
Amino Acid sequence : | |||
| PVVSKKTASPPGESHYYYAETAVSRSLRKDNLGPFVLLQGAQRGPSACITAQGLKSRERPGLEELGSDPLYEDPIFTEKVFRDAMACHARLTTSAVIENYGEGFRGVGSLADVGGSYGMT LGMLVKAFPWIRGICYDLPQVVAKAKPLHGVEFVAGSMFESVPKADLVMLMFVLHNWSDNECIDILKRCKEAIPRETGKVMIIDAIIDEDGEGDEFGGARLRLDVTMMAVTFEGKERTHR EWAYILKEAGFRKYVVKNI | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 28,627.652 | ||
| Theoretical pI: | 6.037 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30160 | ||
| Instability index: | 37.641 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.145 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.220 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336942.1 | internal | 259 | 1-777(+) |
Amino Acid sequence : | |||
| PVVSKKTASPPGESHYYYAETAVSRSLRKDNLGPFVLLQGAQRGPSACITAQGLKSRERPGLEELGSDPLYEDPIFTEKVFRDAMACHARLTTSAVIENYGEGFRGVGSLADVGGSYGMT LGMLVKAFPWIRGICYDLPQVVAKAKPLHGVEFVAGSMFESVPKADLVMLMFVLHNWSDNECIDILKRCKEAIPRETGKVMIIDAIIDEDGEGDEFGGARLRLDVTMMAVTFEGKERTHR EWAYILKEAGFRKYVVKNI | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 28,627.652 | ||
| Theoretical pI: | 6.037 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30160 | ||
| Instability index: | 37.641 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.145 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.220 | ||
| sheet | 0.282 | ||