| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336952.1 | 5prime_partial | 181 | 628-83(-) |
Amino Acid sequence : | |||
| TRVIPRSPQQAKGLLLSSIRDPNPVVFFEPKLLFRMAVEEVPKDDYMLPLFEAEVLREGTDIPLVGWGAQLFIMEQACVEAAKEGIFCELIALKTLIPWDKETVEASVKKTGRLLISHEA PVTGGFGAEIFAFIVERCFPRLEAPVARVCGLDTPFPLVFEPFYLPTTNKILDAIKFTVSY* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 20,243.520 | ||
| Theoretical pI: | 5.045 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 37.483 | ||
| aromaticity | 0.105 | ||
| GRAVY | 0.245 | ||
Secondary Structure Fraction | |||
| Helix | 0.370 | ||
| turn | 0.188 | ||
| sheet | 0.304 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336952.1 | 5prime_partial | 181 | 628-83(-) |
Amino Acid sequence : | |||
| TRVIPRSPQQAKGLLLSSIRDPNPVVFFEPKLLFRMAVEEVPKDDYMLPLFEAEVLREGTDIPLVGWGAQLFIMEQACVEAAKEGIFCELIALKTLIPWDKETVEASVKKTGRLLISHEA PVTGGFGAEIFAFIVERCFPRLEAPVARVCGLDTPFPLVFEPFYLPTTNKILDAIKFTVSY* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 20,243.520 | ||
| Theoretical pI: | 5.045 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 37.483 | ||
| aromaticity | 0.105 | ||
| GRAVY | 0.245 | ||
Secondary Structure Fraction | |||
| Helix | 0.370 | ||
| turn | 0.188 | ||
| sheet | 0.304 | ||