| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336954.1 | internal | 275 | 1-825(+) |
Amino Acid sequence : | |||
| PFTGKDPNVTVNPDPFVALGAAVQAGVLAGDVSDIVLLDVTPLSIGLETLGGVMTKIIPRNTTLPTSKSEVFSTAADSQTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEV KFDIDANGILSVTAIDKGTGKKQDITITGASTLPSDEVERMVSEADKFAKEDKEKRDAIDTKNQADSVVYQTEKQLKELGDKVPAPVKEKVEAKLGELKDAISGGSTQAMKDAMTALNQE VMQIGQSLYGNQPGAAGPTPNSSESSDKGPSDGDV | |||
Physicochemical properties | |||
| Number of amino acids: | 275 | ||
| Molecular weight: | 28,909.064 | ||
| Theoretical pI: | 4.591 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 25.969 | ||
| aromaticity | 0.033 | ||
| GRAVY | -0.373 | ||
Secondary Structure Fraction | |||
| Helix | 0.247 | ||
| turn | 0.273 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336954.1 | internal | 275 | 1-825(+) |
Amino Acid sequence : | |||
| PFTGKDPNVTVNPDPFVALGAAVQAGVLAGDVSDIVLLDVTPLSIGLETLGGVMTKIIPRNTTLPTSKSEVFSTAADSQTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEV KFDIDANGILSVTAIDKGTGKKQDITITGASTLPSDEVERMVSEADKFAKEDKEKRDAIDTKNQADSVVYQTEKQLKELGDKVPAPVKEKVEAKLGELKDAISGGSTQAMKDAMTALNQE VMQIGQSLYGNQPGAAGPTPNSSESSDKGPSDGDV | |||
Physicochemical properties | |||
| Number of amino acids: | 275 | ||
| Molecular weight: | 28,909.064 | ||
| Theoretical pI: | 4.591 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 25.969 | ||
| aromaticity | 0.033 | ||
| GRAVY | -0.373 | ||
Secondary Structure Fraction | |||
| Helix | 0.247 | ||
| turn | 0.273 | ||
| sheet | 0.236 | ||