| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336956.1 | 5prime_partial | 141 | 699-274(-) |
Amino Acid sequence : | |||
| KGIKGEEKVCATSLESRVDFAPSKIGNNVEAVSTEADSSERKVSRFEGVSRKPSDNPVVVCPQQEYEYAVFYCPKTETTVAYDVFFVGAGGSKAEVVAVSHRDPGEWNPKHLAFQVLKVK PGTVPFSHYFPENPIVWVWKN* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 12,206.319 | ||
| Theoretical pI: | 11.864 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 54.573 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.260 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.257 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336956.1 | complete | 137 | 255-668(+) |
Amino Acid sequence : | |||
| MLNYYSSNSSKPTQWDSQGNNGKMAQSLASPSTPEKPNASGSTPPGPYGTPPQPQPSTRRPPRKKHRRPPSSQSWGSKTQHTHTPAGGTQPPGCHSASSKLPRNGTLSSPNYPLLSKLLR RCSLFLMGRNQPWTPKK* | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 12,206.319 | ||
| Theoretical pI: | 11.864 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 54.573 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.260 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.257 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336956.1 | complete | 105 | 316-633(+) |
Amino Acid sequence : | |||
| MGKWHSPWLHLQHLKSQMLRVPLPRVPMGHRHNLSLRPAGPHEKNIVGHRRLSLGAVKHSILILLLGAHNHRVVTRLPRNSLETGHFPLRTIRFCRNCFDVVPYF* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 12,206.319 | ||
| Theoretical pI: | 11.864 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 54.573 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.260 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.257 | ||
| sheet | 0.229 | ||