| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336967.1 | internal | 258 | 1-774(+) |
Amino Acid sequence : | |||
| HNLILLQPSTIPKMGRKFFVGGNWKCNGTTEEVKKIVSTLNAAQLPSPDVVEVVVSPPFVFLPLVKESLRPDFHVAAQNCWVKKGGAYTGEVSAEMLVNLNVPWVILGHSERRALLNESN EFVGEKVAYALSQGLKVIACIGETLEQREAGTTVDVVAAQTKAIAERISDWTNVVLAYEPVWAIGTGKVATPAQAQEVHFELRKWLQANVNAAVASSTRIIYGGSVNGGNCKELAGQTDV DGFLVGGASLKPEFIDII | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 27,794.568 | ||
| Theoretical pI: | 5.877 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38960 39210 | ||
| Instability index: | 30.330 | ||
| aromaticity | 0.074 | ||
| GRAVY | 0.097 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.240 | ||
| sheet | 0.267 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336967.1 | internal | 258 | 1-774(+) |
Amino Acid sequence : | |||
| HNLILLQPSTIPKMGRKFFVGGNWKCNGTTEEVKKIVSTLNAAQLPSPDVVEVVVSPPFVFLPLVKESLRPDFHVAAQNCWVKKGGAYTGEVSAEMLVNLNVPWVILGHSERRALLNESN EFVGEKVAYALSQGLKVIACIGETLEQREAGTTVDVVAAQTKAIAERISDWTNVVLAYEPVWAIGTGKVATPAQAQEVHFELRKWLQANVNAAVASSTRIIYGGSVNGGNCKELAGQTDV DGFLVGGASLKPEFIDII | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 27,794.568 | ||
| Theoretical pI: | 5.877 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38960 39210 | ||
| Instability index: | 30.330 | ||
| aromaticity | 0.074 | ||
| GRAVY | 0.097 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.240 | ||
| sheet | 0.267 | ||