Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336967.1 | internal | 258 | 1-774(+) |
Amino Acid sequence : | |||
HNLILLQPSTIPKMGRKFFVGGNWKCNGTTEEVKKIVSTLNAAQLPSPDVVEVVVSPPFVFLPLVKESLRPDFHVAAQNCWVKKGGAYTGEVSAEMLVNLNVPWVILGHSERRALLNESN EFVGEKVAYALSQGLKVIACIGETLEQREAGTTVDVVAAQTKAIAERISDWTNVVLAYEPVWAIGTGKVATPAQAQEVHFELRKWLQANVNAAVASSTRIIYGGSVNGGNCKELAGQTDV DGFLVGGASLKPEFIDII | |||
Physicochemical properties | |||
Number of amino acids: | 258 | ||
Molecular weight: | 27,794.568 | ||
Theoretical pI: | 5.877 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38960 39210 | ||
Instability index: | 30.330 | ||
aromaticity | 0.074 | ||
GRAVY | 0.097 | ||
Secondary Structure Fraction | |||
Helix | 0.337 | ||
turn | 0.240 | ||
sheet | 0.267 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336967.1 | internal | 258 | 1-774(+) |
Amino Acid sequence : | |||
HNLILLQPSTIPKMGRKFFVGGNWKCNGTTEEVKKIVSTLNAAQLPSPDVVEVVVSPPFVFLPLVKESLRPDFHVAAQNCWVKKGGAYTGEVSAEMLVNLNVPWVILGHSERRALLNESN EFVGEKVAYALSQGLKVIACIGETLEQREAGTTVDVVAAQTKAIAERISDWTNVVLAYEPVWAIGTGKVATPAQAQEVHFELRKWLQANVNAAVASSTRIIYGGSVNGGNCKELAGQTDV DGFLVGGASLKPEFIDII | |||
Physicochemical properties | |||
Number of amino acids: | 258 | ||
Molecular weight: | 27,794.568 | ||
Theoretical pI: | 5.877 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38960 39210 | ||
Instability index: | 30.330 | ||
aromaticity | 0.074 | ||
GRAVY | 0.097 | ||
Secondary Structure Fraction | |||
Helix | 0.337 | ||
turn | 0.240 | ||
sheet | 0.267 |