| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336974.1 | 5prime_partial | 132 | 489-91(-) |
Amino Acid sequence : | |||
| EWGATELCRGGNTEHVEVIQGIERGDALPGLRPYSDIAAMAKKVGFEVVKEKDLAKPPSQPWWTRLKMGRIAYWRNHILVTVLAWLGIAPKGVVDVHEMLFVPADYLTRGGETGIFTPMH MILCRKPESKSD* | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 13,736.642 | ||
| Theoretical pI: | 11.187 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 77.787 | ||
| aromaticity | 0.033 | ||
| GRAVY | -0.639 | ||
Secondary Structure Fraction | |||
| Helix | 0.258 | ||
| turn | 0.258 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336974.1 | 3prime_partial | 120 | 130-489(+) |
Amino Acid sequence : | |||
| MHRRENPGFAASSQIISRNEQHFMDIHHALGCDSQPREHGNQNVVPPIRDSSHLQPRPPRLRRRLRQILLLHHFEPYLLRHGGDVAVGAEPRQCVAPLDPLNHLHVLRVAPAAKLRRPPL | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 13,736.642 | ||
| Theoretical pI: | 11.187 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 77.787 | ||
| aromaticity | 0.033 | ||
| GRAVY | -0.639 | ||
Secondary Structure Fraction | |||
| Helix | 0.258 | ||
| turn | 0.258 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336974.1 | 5prime_partial | 132 | 489-91(-) |
Amino Acid sequence : | |||
| EWGATELCRGGNTEHVEVIQGIERGDALPGLRPYSDIAAMAKKVGFEVVKEKDLAKPPSQPWWTRLKMGRIAYWRNHILVTVLAWLGIAPKGVVDVHEMLFVPADYLTRGGETGIFTPMH MILCRKPESKSD* | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 13,736.642 | ||
| Theoretical pI: | 11.187 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 77.787 | ||
| aromaticity | 0.033 | ||
| GRAVY | -0.639 | ||
Secondary Structure Fraction | |||
| Helix | 0.258 | ||
| turn | 0.258 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336974.1 | 3prime_partial | 120 | 130-489(+) |
Amino Acid sequence : | |||
| MHRRENPGFAASSQIISRNEQHFMDIHHALGCDSQPREHGNQNVVPPIRDSSHLQPRPPRLRRRLRQILLLHHFEPYLLRHGGDVAVGAEPRQCVAPLDPLNHLHVLRVAPAAKLRRPPL | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 13,736.642 | ||
| Theoretical pI: | 11.187 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 77.787 | ||
| aromaticity | 0.033 | ||
| GRAVY | -0.639 | ||
Secondary Structure Fraction | |||
| Helix | 0.258 | ||
| turn | 0.258 | ||
| sheet | 0.258 | ||