| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336994.1 | 5prime_partial | 242 | 3-731(+) |
Amino Acid sequence : | |||
| ALSYHMRSYFWLHFQQLNDIYRYKTEEYSHTAVNKFNVIPDSIPDWVFDFMPTRGGYFIGNVSPARMDFRWFALGNCVAILSSLATPDQAAAIMDLFEERWEELVGEMPLKICYPAIESH EWRIVTGCDPKNTRWSYHNGGSWPVLLWLLTAACIKTGRPQIARRAIDLAESRLLKDGWPEYYDGKSGRYIGKQARKYQTWSIAGYLVAKMLLEDPSHLGMISLEEDKQMKPIIKRSSSW TC* | |||
Physicochemical properties | |||
| Number of amino acids: | 242 | ||
| Molecular weight: | 11,397.010 | ||
| Theoretical pI: | 11.404 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 43.958 | ||
| aromaticity | 0.010 | ||
| GRAVY | -0.740 | ||
Secondary Structure Fraction | |||
| Helix | 0.218 | ||
| turn | 0.198 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336994.1 | complete | 101 | 443-748(+) |
Amino Acid sequence : | |||
| MAANSCLHQNRAPTNRKTSHRSCREPTAKGRLARVLRREVRKIHRETSPKIPDLVHRRIPRGKDAVGGSVAFRDDLARRGQANEAHHQEILIVDLLIKIGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,397.010 | ||
| Theoretical pI: | 11.404 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 43.958 | ||
| aromaticity | 0.010 | ||
| GRAVY | -0.740 | ||
Secondary Structure Fraction | |||
| Helix | 0.218 | ||
| turn | 0.198 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336994.1 | 5prime_partial | 242 | 3-731(+) |
Amino Acid sequence : | |||
| ALSYHMRSYFWLHFQQLNDIYRYKTEEYSHTAVNKFNVIPDSIPDWVFDFMPTRGGYFIGNVSPARMDFRWFALGNCVAILSSLATPDQAAAIMDLFEERWEELVGEMPLKICYPAIESH EWRIVTGCDPKNTRWSYHNGGSWPVLLWLLTAACIKTGRPQIARRAIDLAESRLLKDGWPEYYDGKSGRYIGKQARKYQTWSIAGYLVAKMLLEDPSHLGMISLEEDKQMKPIIKRSSSW TC* | |||
Physicochemical properties | |||
| Number of amino acids: | 242 | ||
| Molecular weight: | 11,397.010 | ||
| Theoretical pI: | 11.404 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 43.958 | ||
| aromaticity | 0.010 | ||
| GRAVY | -0.740 | ||
Secondary Structure Fraction | |||
| Helix | 0.218 | ||
| turn | 0.198 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336994.1 | complete | 101 | 443-748(+) |
Amino Acid sequence : | |||
| MAANSCLHQNRAPTNRKTSHRSCREPTAKGRLARVLRREVRKIHRETSPKIPDLVHRRIPRGKDAVGGSVAFRDDLARRGQANEAHHQEILIVDLLIKIGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,397.010 | ||
| Theoretical pI: | 11.404 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 43.958 | ||
| aromaticity | 0.010 | ||
| GRAVY | -0.740 | ||
Secondary Structure Fraction | |||
| Helix | 0.218 | ||
| turn | 0.198 | ||
| sheet | 0.248 | ||