Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337016.1	complete	128	22-408(+)
Amino Acid sequence :
MRYIDSNIDYRHPVAIYQNKGNQTESDRPSKSKPNFSSFPRQIHHSSRSSRVRHHNHHLRCGYHRNHRRCGCYRNRLHNHHILHCRHRILHRSLHNYSHGDRNHHRCRLHHGEGHGIHRR LHHETEPR*
Physicochemical properties
Number of amino acids:		128
Molecular weight:		11,442.261
Theoretical pI:		4.327
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5500
Instability index:		10.713
aromaticity		0.027
GRAVY		0.956
Secondary Structure Fraction
Helix		0.364
turn		0.100
sheet		0.355

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337016.1	complete	114	466-122(-)
Amino Acid sequence :
MRDAIDAMNGQDLDGRNITVNEAQSRGGGGGGFRGPRRDGGGNGGGYGRRENSYGGNGGGYGGDSGGYGGYGGGYGSSRSGGGYGGSRSGGGGYGGERGYSSRSGGSAEGNWRN*
Physicochemical properties
Number of amino acids:		114
Molecular weight:		11,442.261
Theoretical pI:		4.327
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5500
Instability index:		10.713
aromaticity		0.027
GRAVY		0.956
Secondary Structure Fraction
Helix		0.364
turn		0.100
sheet		0.355

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337016.1	complete	110	441-109(-)
Amino Acid sequence :
MVRIWTDVTSPSTRLSLVVEAAVDSVALAVMEAATVVVTVAVRIVMEGTVEDTVATVEDMVVMEAVTVAAAAAVVTVVAAAEVVVMVANAATPRGVVDLPRETGEIRFRF*
Physicochemical properties
Number of amino acids:		110
Molecular weight:		11,442.261
Theoretical pI:		4.327
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5500
Instability index:		10.713
aromaticity		0.027
GRAVY		0.956
Secondary Structure Fraction
Helix		0.364
turn		0.100
sheet		0.355