| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337017.1 | 5prime_partial | 231 | 787-92(-) |
Amino Acid sequence : | |||
| TWSEYTVVDSNFVVKVDPRIPLPHASLLTCGFMTGYGAPWRESRVEKGSTVAVIGLGAVGLGAVSASRILGASKIIGIDVNELKRDKARVFGVTEFINPKHSDKTVSQLIQEATGGLGVD CCIECTGISSLLNEAIASTKVGIGEVVLISAGEEEKVEISYFPLLFGRSVKGTTLGGVRIHSDLPKIVEKCINKEIDLDELITHEVSLADVNKGFMEYMNQPDCVKVSVKF* | |||
Physicochemical properties | |||
| Number of amino acids: | 231 | ||
| Molecular weight: | 10,750.239 | ||
| Theoretical pI: | 6.015 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 68.281 | ||
| aromaticity | 0.050 | ||
| GRAVY | 0.022 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.310 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337017.1 | complete | 100 | 381-683(+) |
Amino Acid sequence : | |||
| MASLRREEMPVHSMQQSTPNPPVASWISCDTVLSECLGFMNSVTPKTLALSRLSSFTSIPIIFDAPRIRDALTAPSPTAPRPITATVDPFSTLDSLHGAP* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 10,750.239 | ||
| Theoretical pI: | 6.015 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 68.281 | ||
| aromaticity | 0.050 | ||
| GRAVY | 0.022 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.310 | ||
| sheet | 0.250 | ||