| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337018.1 | 5prime_partial | 187 | 2-565(+) |
Amino Acid sequence : | |||
| ARGLILSSPLKMTNMFASAAPISTNNTTVEDMRRSVTYHPSGWKDHFLNYASPVTEVEMEQLEKQKERIKTLLAQTPDDSMLKVKLIDAIQRLRVGYHFEKEINRSLQQIHDTFQISSKD NDVHAVALSFRLLRQQGYPVPSDVFKKFIHDQGKLEELVMNDVDGMLSLYEASNYGMDGEDILDKAL* | |||
Physicochemical properties | |||
| Number of amino acids: | 187 | ||
| Molecular weight: | 21,346.056 | ||
| Theoretical pI: | 5.680 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 41.950 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.445 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.203 | ||
| sheet | 0.273 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337018.1 | 5prime_partial | 187 | 2-565(+) |
Amino Acid sequence : | |||
| ARGLILSSPLKMTNMFASAAPISTNNTTVEDMRRSVTYHPSGWKDHFLNYASPVTEVEMEQLEKQKERIKTLLAQTPDDSMLKVKLIDAIQRLRVGYHFEKEINRSLQQIHDTFQISSKD NDVHAVALSFRLLRQQGYPVPSDVFKKFIHDQGKLEELVMNDVDGMLSLYEASNYGMDGEDILDKAL* | |||
Physicochemical properties | |||
| Number of amino acids: | 187 | ||
| Molecular weight: | 21,346.056 | ||
| Theoretical pI: | 5.680 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 41.950 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.445 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.203 | ||
| sheet | 0.273 | ||