Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337025.1	3prime_partial	228	48-731(+)
Amino Acid sequence :
MIKYTSIISVSNIISESNQGGSPVRIKVKQLFLCLPIQFVRQFSGFLHPNQLWIRGFIRRQILSGRLPQFRRRFRHIQNVVHHLKQQPYTARKSPQFLNFLLVRSSHNCPQNHRRLHQRR RLQAVDQLQMIESHRRHPLRAHIHHLPPGQPLRPDQIRQLPHRPHHSLRRHAPRRRGHVFERERQHGVAGQHRRVLAEHLVVGGLPAAEVVVVHAGQVVVHQGHCLDH
Physicochemical properties
Number of amino acids:		228
Molecular weight:		12,794.539
Theoretical pI:		11.005
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 125
Instability index:		57.514
aromaticity		0.008
GRAVY		-1.098
Secondary Structure Fraction
Helix		0.100
turn		0.431
sheet		0.169

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337025.1	complete	222	731-63(-)
Amino Acid sequence :
MIQTMSLMHDDLPCMDNDDLRRGKPTNHKVFGENAAVLAGDAMLSFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVCAEGMAAVGLDHLELIHRLKTAALVQASVVLGA VVGGANEEEIEKLRRFASCIGLLFQVVDDILDVTKSSAELGKTAGKDLAADKATYPKLIGVEKSRELADKLNREAKEQLLHFDPHRAAPLVALADYIAYRDY*
Physicochemical properties
Number of amino acids:		222
Molecular weight:		12,794.539
Theoretical pI:		11.005
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 125
Instability index:		57.514
aromaticity		0.008
GRAVY		-1.098
Secondary Structure Fraction
Helix		0.100
turn		0.431
sheet		0.169

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337025.1	5prime_partial	130	732-340(-)
Amino Acid sequence :
DDPDNVLDARRPALHGQRRPPPREAHQPQGVRRERGGAGRRRHAVVRVRTRGRGDEGRGAGESGEGGAGAGEFDRVGGAVRGAGGGCVRGGDGGGGTRSSGVDPPPEDGGAGAGVGGSGG SCGRSERGGN*
Physicochemical properties
Number of amino acids:		130
Molecular weight:		12,794.539
Theoretical pI:		11.005
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 125
Instability index:		57.514
aromaticity		0.008
GRAVY		-1.098
Secondary Structure Fraction
Helix		0.100
turn		0.431
sheet		0.169

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337025.1	3prime_partial	228	48-731(+)
Amino Acid sequence :
MIKYTSIISVSNIISESNQGGSPVRIKVKQLFLCLPIQFVRQFSGFLHPNQLWIRGFIRRQILSGRLPQFRRRFRHIQNVVHHLKQQPYTARKSPQFLNFLLVRSSHNCPQNHRRLHQRR RLQAVDQLQMIESHRRHPLRAHIHHLPPGQPLRPDQIRQLPHRPHHSLRRHAPRRRGHVFERERQHGVAGQHRRVLAEHLVVGGLPAAEVVVVHAGQVVVHQGHCLDH
Physicochemical properties
Number of amino acids:		228
Molecular weight:		12,794.539
Theoretical pI:		11.005
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 125
Instability index:		57.514
aromaticity		0.008
GRAVY		-1.098
Secondary Structure Fraction
Helix		0.100
turn		0.431
sheet		0.169

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337025.1	complete	222	731-63(-)
Amino Acid sequence :
MIQTMSLMHDDLPCMDNDDLRRGKPTNHKVFGENAAVLAGDAMLSFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVCAEGMAAVGLDHLELIHRLKTAALVQASVVLGA VVGGANEEEIEKLRRFASCIGLLFQVVDDILDVTKSSAELGKTAGKDLAADKATYPKLIGVEKSRELADKLNREAKEQLLHFDPHRAAPLVALADYIAYRDY*
Physicochemical properties
Number of amino acids:		222
Molecular weight:		12,794.539
Theoretical pI:		11.005
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 125
Instability index:		57.514
aromaticity		0.008
GRAVY		-1.098
Secondary Structure Fraction
Helix		0.100
turn		0.431
sheet		0.169

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337025.1	5prime_partial	130	732-340(-)
Amino Acid sequence :
DDPDNVLDARRPALHGQRRPPPREAHQPQGVRRERGGAGRRRHAVVRVRTRGRGDEGRGAGESGEGGAGAGEFDRVGGAVRGAGGGCVRGGDGGGGTRSSGVDPPPEDGGAGAGVGGSGG SCGRSERGGN*
Physicochemical properties
Number of amino acids:		130
Molecular weight:		12,794.539
Theoretical pI:		11.005
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 125
Instability index:		57.514
aromaticity		0.008
GRAVY		-1.098
Secondary Structure Fraction
Helix		0.100
turn		0.431
sheet		0.169