| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337047.1 | 5prime_partial | 231 | 800-105(-) |
Amino Acid sequence : | |||
| SKANIVAVSVNYRLAPEYLLPTAYQDCWLALKWVFSHSNGNGNEKWLRNDVDFDRVYLGGDSAGGNIAHNVAMRVGTEKMECDDKGIMVHGLFLNCPHFWGSSRIGNEASFPKAMIETEE SIWIHAYPTSSGFDDPASNPGKDPNLWKLGCKKVLVYVAGNDVLKERGLYYAKVLKESGWRGGVKSVEVKGENHVFNLKFPYNRDARDMMGNVALFLNDKLKLSHNTYTSN* | |||
Physicochemical properties | |||
| Number of amino acids: | 231 | ||
| Molecular weight: | 15,970.705 | ||
| Theoretical pI: | 11.511 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 53.613 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.134 | ||
Secondary Structure Fraction | |||
| Helix | 0.338 | ||
| turn | 0.191 | ||
| sheet | 0.191 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337047.1 | complete | 136 | 219-629(+) |
Amino Acid sequence : | |||
| MIFPLHLHTLDTSSPSTLFQHLGIIQPPLFQHIIPCNINQHFFTPQLPKIRILTRIRRRVIKPARSWVCMDPYTLLRLYHRFRKTRFIPNSATSPEMWTVQKQTMDHNTLIITLHLLRPH PHRHVVRDVAAGAVPA* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 15,970.705 | ||
| Theoretical pI: | 11.511 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 53.613 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.134 | ||
Secondary Structure Fraction | |||
| Helix | 0.338 | ||
| turn | 0.191 | ||
| sheet | 0.191 | ||