Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337047.1 | 5prime_partial | 231 | 800-105(-) |
Amino Acid sequence : | |||
SKANIVAVSVNYRLAPEYLLPTAYQDCWLALKWVFSHSNGNGNEKWLRNDVDFDRVYLGGDSAGGNIAHNVAMRVGTEKMECDDKGIMVHGLFLNCPHFWGSSRIGNEASFPKAMIETEE SIWIHAYPTSSGFDDPASNPGKDPNLWKLGCKKVLVYVAGNDVLKERGLYYAKVLKESGWRGGVKSVEVKGENHVFNLKFPYNRDARDMMGNVALFLNDKLKLSHNTYTSN* | |||
Physicochemical properties | |||
Number of amino acids: | 231 | ||
Molecular weight: | 15,970.705 | ||
Theoretical pI: | 11.511 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 53.613 | ||
aromaticity | 0.081 | ||
GRAVY | -0.134 | ||
Secondary Structure Fraction | |||
Helix | 0.338 | ||
turn | 0.191 | ||
sheet | 0.191 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337047.1 | complete | 136 | 219-629(+) |
Amino Acid sequence : | |||
MIFPLHLHTLDTSSPSTLFQHLGIIQPPLFQHIIPCNINQHFFTPQLPKIRILTRIRRRVIKPARSWVCMDPYTLLRLYHRFRKTRFIPNSATSPEMWTVQKQTMDHNTLIITLHLLRPH PHRHVVRDVAAGAVPA* | |||
Physicochemical properties | |||
Number of amino acids: | 136 | ||
Molecular weight: | 15,970.705 | ||
Theoretical pI: | 11.511 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 53.613 | ||
aromaticity | 0.081 | ||
GRAVY | -0.134 | ||
Secondary Structure Fraction | |||
Helix | 0.338 | ||
turn | 0.191 | ||
sheet | 0.191 |