Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337054.1 | internal | 126 | 3-380(+) |
Amino Acid sequence : | |||
FSSMLWMYYPLIKTNAILQISINLLGCVIDTAYIFLFLLYASKKARAHTAKILGLMNVGLLCVIFVLTFFIFSGHTRVQVVGWICVAISISVFAAPLSIVFLVIRTLSEEFMPFPLSFFL TLSALM | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 14,137.076 | ||
Theoretical pI: | 9.221 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 30.698 | ||
aromaticity | 0.151 | ||
GRAVY | 1.302 | ||
Secondary Structure Fraction | |||
Helix | 0.508 | ||
turn | 0.183 | ||
sheet | 0.294 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337054.1 | internal | 126 | 3-380(+) |
Amino Acid sequence : | |||
FSSMLWMYYPLIKTNAILQISINLLGCVIDTAYIFLFLLYASKKARAHTAKILGLMNVGLLCVIFVLTFFIFSGHTRVQVVGWICVAISISVFAAPLSIVFLVIRTLSEEFMPFPLSFFL TLSALM | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 14,137.076 | ||
Theoretical pI: | 9.221 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 30.698 | ||
aromaticity | 0.151 | ||
GRAVY | 1.302 | ||
Secondary Structure Fraction | |||
Helix | 0.508 | ||
turn | 0.183 | ||
sheet | 0.294 |