| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337054.1 | internal | 126 | 3-380(+) |
Amino Acid sequence : | |||
| FSSMLWMYYPLIKTNAILQISINLLGCVIDTAYIFLFLLYASKKARAHTAKILGLMNVGLLCVIFVLTFFIFSGHTRVQVVGWICVAISISVFAAPLSIVFLVIRTLSEEFMPFPLSFFL TLSALM | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 14,137.076 | ||
| Theoretical pI: | 9.221 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 30.698 | ||
| aromaticity | 0.151 | ||
| GRAVY | 1.302 | ||
Secondary Structure Fraction | |||
| Helix | 0.508 | ||
| turn | 0.183 | ||
| sheet | 0.294 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337054.1 | internal | 126 | 3-380(+) |
Amino Acid sequence : | |||
| FSSMLWMYYPLIKTNAILQISINLLGCVIDTAYIFLFLLYASKKARAHTAKILGLMNVGLLCVIFVLTFFIFSGHTRVQVVGWICVAISISVFAAPLSIVFLVIRTLSEEFMPFPLSFFL TLSALM | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 14,137.076 | ||
| Theoretical pI: | 9.221 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 30.698 | ||
| aromaticity | 0.151 | ||
| GRAVY | 1.302 | ||
Secondary Structure Fraction | |||
| Helix | 0.508 | ||
| turn | 0.183 | ||
| sheet | 0.294 | ||