| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337056.1 | complete | 238 | 50-766(+) |
Amino Acid sequence : | |||
| MLMQATPVTRSPAGLSGEALKTGTPLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVD FVGGDMFESLPKADAVMLMWVLHDWSDDKCIEILKKCKEAIPTSTGKVMIVDAIINEEGEGDEFSGARLSLDMTMMAMTTQGKERSYKEWVHLLNEAGFSKHTVKNIKTIEFVIEAYP* | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 26,054.757 | ||
| Theoretical pI: | 5.709 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 35075 | ||
| Instability index: | 22.700 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.068 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.218 | ||
| sheet | 0.294 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337056.1 | complete | 238 | 50-766(+) |
Amino Acid sequence : | |||
| MLMQATPVTRSPAGLSGEALKTGTPLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVD FVGGDMFESLPKADAVMLMWVLHDWSDDKCIEILKKCKEAIPTSTGKVMIVDAIINEEGEGDEFSGARLSLDMTMMAMTTQGKERSYKEWVHLLNEAGFSKHTVKNIKTIEFVIEAYP* | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 26,054.757 | ||
| Theoretical pI: | 5.709 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 35075 | ||
| Instability index: | 22.700 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.068 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.218 | ||
| sheet | 0.294 | ||