| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337059.1 | internal | 107 | 2-322(+) |
Amino Acid sequence : | |||
| TLTISQVAAIATTDNAVSVQLSEAAMAGVKASSDWVMEIMNKGTDSYGVTTGFGATSHRRTKQGGALQKELITFLNAGIFGNGTESNHTLPHTATRAAMLVRINTLL | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 11,208.581 | ||
| Theoretical pI: | 8.136 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 27.279 | ||
| aromaticity | 0.047 | ||
| GRAVY | 0.041 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.234 | ||
| sheet | 0.290 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337059.1 | internal | 107 | 2-322(+) |
Amino Acid sequence : | |||
| TLTISQVAAIATTDNAVSVQLSEAAMAGVKASSDWVMEIMNKGTDSYGVTTGFGATSHRRTKQGGALQKELITFLNAGIFGNGTESNHTLPHTATRAAMLVRINTLL | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 11,208.581 | ||
| Theoretical pI: | 8.136 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 27.279 | ||
| aromaticity | 0.047 | ||
| GRAVY | 0.041 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.234 | ||
| sheet | 0.290 | ||