Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337062.1 | 3prime_partial | 120 | 176-535(+) |
Amino Acid sequence : | |||
MRFLAHHGVSKKTASPPGESDYYYAETAVSRSLTKDNLGPFVLLQGAQRGPSACIRAQGLKSRERPGVEELGSDPLYEDPIFTEKVFRDAMTCHARVTTSAVIENYGEGFRGVGSLVDVG | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 13,021.476 | ||
Theoretical pI: | 6.282 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
Instability index: | 39.243 | ||
aromaticity | 0.083 | ||
GRAVY | -0.374 | ||
Secondary Structure Fraction | |||
Helix | 0.267 | ||
turn | 0.267 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337062.1 | 3prime_partial | 120 | 176-535(+) |
Amino Acid sequence : | |||
MRFLAHHGVSKKTASPPGESDYYYAETAVSRSLTKDNLGPFVLLQGAQRGPSACIRAQGLKSRERPGVEELGSDPLYEDPIFTEKVFRDAMTCHARVTTSAVIENYGEGFRGVGSLVDVG | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 13,021.476 | ||
Theoretical pI: | 6.282 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
Instability index: | 39.243 | ||
aromaticity | 0.083 | ||
GRAVY | -0.374 | ||
Secondary Structure Fraction | |||
Helix | 0.267 | ||
turn | 0.267 | ||
sheet | 0.250 |