| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337062.1 | 3prime_partial | 120 | 176-535(+) |
Amino Acid sequence : | |||
| MRFLAHHGVSKKTASPPGESDYYYAETAVSRSLTKDNLGPFVLLQGAQRGPSACIRAQGLKSRERPGVEELGSDPLYEDPIFTEKVFRDAMTCHARVTTSAVIENYGEGFRGVGSLVDVG | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 13,021.476 | ||
| Theoretical pI: | 6.282 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 39.243 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.374 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.267 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337062.1 | 3prime_partial | 120 | 176-535(+) |
Amino Acid sequence : | |||
| MRFLAHHGVSKKTASPPGESDYYYAETAVSRSLTKDNLGPFVLLQGAQRGPSACIRAQGLKSRERPGVEELGSDPLYEDPIFTEKVFRDAMTCHARVTTSAVIENYGEGFRGVGSLVDVG | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 13,021.476 | ||
| Theoretical pI: | 6.282 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 39.243 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.374 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.267 | ||
| sheet | 0.250 | ||