Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337067.1	3prime_partial	146	194-631(+)
Amino Acid sequence :
MTYMFKYDSVRGQWKHHELKVKDEKTLLFGEKSVTVFGIRNPQEIPWAETGAEYIGESTGVFTDKDRAAAHLKGGANKVIISAPSKDAPMFVVGVNEKTYTPDLNIVSDASCTTNCLAPL AKVINDRLGIVEGLMTTVHSITATQK
Physicochemical properties
Number of amino acids:		146
Molecular weight:		13,833.027
Theoretical pI:		9.917
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 21095
Instability index:		55.735
aromaticity		0.110
GRAVY		0.365
Secondary Structure Fraction
Helix		0.339
turn		0.291
sheet		0.252

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337067.1	3prime_partial	135	406-2(-)
Amino Acid sequence :
MGCSPIFVSENTSGLPNVFSTSLSPWNLLWVSDAKNSHRFFTKEKGFLILNLELMVLPLATNTVILEHIGHVISSDERIVDSNKLNVVSLKSTPSNETANSSESINSDLNPSSFVERETE RSEEPKSKRENKCLV
Physicochemical properties
Number of amino acids:		135
Molecular weight:		13,833.027
Theoretical pI:		9.917
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 21095
Instability index:		55.735
aromaticity		0.110
GRAVY		0.365
Secondary Structure Fraction
Helix		0.339
turn		0.291
sheet		0.252

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337067.1	complete	127	582-199(-)
Amino Acid sequence :
MPSRSLITFANGARQFVVQLASDTMLRSGVYVFSLTPTTNIGASLLGAEIMTLLAPPFKWAAALSLSVKTPVDSPMYSAPVSAHGISCGFLMPKTVTDFSPKRRVFSSLTLSSWCFHWPR TLSYLNI*
Physicochemical properties
Number of amino acids:		127
Molecular weight:		13,833.027
Theoretical pI:		9.917
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 21095
Instability index:		55.735
aromaticity		0.110
GRAVY		0.365
Secondary Structure Fraction
Helix		0.339
turn		0.291
sheet		0.252

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337067.1	3prime_partial	146	194-631(+)
Amino Acid sequence :
MTYMFKYDSVRGQWKHHELKVKDEKTLLFGEKSVTVFGIRNPQEIPWAETGAEYIGESTGVFTDKDRAAAHLKGGANKVIISAPSKDAPMFVVGVNEKTYTPDLNIVSDASCTTNCLAPL AKVINDRLGIVEGLMTTVHSITATQK
Physicochemical properties
Number of amino acids:		146
Molecular weight:		13,833.027
Theoretical pI:		9.917
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 21095
Instability index:		55.735
aromaticity		0.110
GRAVY		0.365
Secondary Structure Fraction
Helix		0.339
turn		0.291
sheet		0.252

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337067.1	3prime_partial	135	406-2(-)
Amino Acid sequence :
MGCSPIFVSENTSGLPNVFSTSLSPWNLLWVSDAKNSHRFFTKEKGFLILNLELMVLPLATNTVILEHIGHVISSDERIVDSNKLNVVSLKSTPSNETANSSESINSDLNPSSFVERETE RSEEPKSKRENKCLV
Physicochemical properties
Number of amino acids:		135
Molecular weight:		13,833.027
Theoretical pI:		9.917
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 21095
Instability index:		55.735
aromaticity		0.110
GRAVY		0.365
Secondary Structure Fraction
Helix		0.339
turn		0.291
sheet		0.252

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337067.1	complete	127	582-199(-)
Amino Acid sequence :
MPSRSLITFANGARQFVVQLASDTMLRSGVYVFSLTPTTNIGASLLGAEIMTLLAPPFKWAAALSLSVKTPVDSPMYSAPVSAHGISCGFLMPKTVTDFSPKRRVFSSLTLSSWCFHWPR TLSYLNI*
Physicochemical properties
Number of amino acids:		127
Molecular weight:		13,833.027
Theoretical pI:		9.917
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 21095
Instability index:		55.735
aromaticity		0.110
GRAVY		0.365
Secondary Structure Fraction
Helix		0.339
turn		0.291
sheet		0.252