| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337068.1 | 5prime_partial | 114 | 3-347(+) |
Amino Acid sequence : | |||
| RSMGYGEKDLSLVSFQSVSKGYYGECGKLGGYVEITGFNTEIREQIYQLASVNLCSNISGQILASLVMSPPKVGDKSYESYSAEKNAILSSLARRAQQLEKALKSLEGVSCNRA* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 12,367.886 | ||
| Theoretical pI: | 8.463 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10555 | ||
| Instability index: | 47.572 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.255 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.307 | ||
| sheet | 0.272 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337068.1 | 5prime_partial | 114 | 3-347(+) |
Amino Acid sequence : | |||
| RSMGYGEKDLSLVSFQSVSKGYYGECGKLGGYVEITGFNTEIREQIYQLASVNLCSNISGQILASLVMSPPKVGDKSYESYSAEKNAILSSLARRAQQLEKALKSLEGVSCNRA* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 12,367.886 | ||
| Theoretical pI: | 8.463 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10555 | ||
| Instability index: | 47.572 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.255 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.307 | ||
| sheet | 0.272 | ||