Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337073.1 | 5prime_partial | 149 | 2-451(+) |
Amino Acid sequence : | |||
HEGDGEKANMLSKVHEERRVVGYSPEQLFDVVAAVDMYEEFLPWCQRSHIIRSNPNGSFDAELKIGFKFLVERYISHVELTKPKCIKTTSSQSNLFDHLINIWEFNPGPVPGSCCVYFKE DFMFQSPLYRQIANMFFKEMVSRLVSSFS* | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 17,296.580 | ||
Theoretical pI: | 5.958 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
Instability index: | 47.874 | ||
aromaticity | 0.134 | ||
GRAVY | -0.267 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.248 | ||
sheet | 0.221 |