| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337075.1 | internal | 244 | 2-733(+) |
Amino Acid sequence : | |||
| RQGFFGLWGFRQRPYPPGRPIDAAQAIGYKRLEKRYHDFIMKSGGWFYKDRLGRSRGPMELIQLKTAWGAGIIDKHTFIWGEDMDEWAPIGMVYGLEKAIATWEVRLGAAATALLHKLQK GIPPWVPLRGHEPKTYKQMQEEAYESRRRDLAVLEANDGVWPGVRIPSHTMFLWASGSELTSILEADHMPNKYIPKDLRKELEKVIPGLRPWEVLSVEQAMDQITYGGEWYREPLGSYTT GPPY | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 28,072.906 | ||
| Theoretical pI: | 8.910 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 78380 78380 | ||
| Instability index: | 36.347 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.533 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.225 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337075.1 | internal | 244 | 2-733(+) |
Amino Acid sequence : | |||
| RQGFFGLWGFRQRPYPPGRPIDAAQAIGYKRLEKRYHDFIMKSGGWFYKDRLGRSRGPMELIQLKTAWGAGIIDKHTFIWGEDMDEWAPIGMVYGLEKAIATWEVRLGAAATALLHKLQK GIPPWVPLRGHEPKTYKQMQEEAYESRRRDLAVLEANDGVWPGVRIPSHTMFLWASGSELTSILEADHMPNKYIPKDLRKELEKVIPGLRPWEVLSVEQAMDQITYGGEWYREPLGSYTT GPPY | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 28,072.906 | ||
| Theoretical pI: | 8.910 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 78380 78380 | ||
| Instability index: | 36.347 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.533 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.225 | ||
| sheet | 0.270 | ||