| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337114.1 | 5prime_partial | 189 | 2-571(+) |
Amino Acid sequence : | |||
| IDSMNLLHRAFSVFLFNSNYELLLQQRSATKVTFPLVWTNTCCSHPLYRESELIEDDALGVRNAAQRKLLDELGIPATDLPVDEFTTLGRILYKAPSDGKWGEHELDYLLFMGRDVGIHP NPNEVADFKYVNREQLKELLRKVDAGEAGLKLSPWIRLIVDNFLFRWWDHVEKGTLALATDMTTIHRLT* | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 13,461.230 | ||
| Theoretical pI: | 6.962 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 51.075 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.248 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.210 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337114.1 | 3prime_partial | 119 | 358-2(-) |
Amino Acid sequence : | |||
| MDANVSSHEEKIIQFVLAPFPVGWCFVQNPAQRRKLVDGEISSRDAELVQKLSLSCVSYSKSIVFDELGFSVERMAAAGVRPHQGKRHLRCRSLLEQQFIIRVEEEHAKSSVQQIHGVD | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,461.230 | ||
| Theoretical pI: | 6.962 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 51.075 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.248 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.210 | ||
| sheet | 0.244 | ||