Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337116.1 | 5prime_partial | 208 | 3-629(+) |
Amino Acid sequence : | |||
LIKTRPLSILGNILTYKNDKHEGSRLKGLPSLKNLLSCSYRLLNILRSMLQAGKPGLKLRRREIHTFLQHRPEELGEFRTITLLGILKIINRPIIEKKTKHSVYIATAYCMTGFLPSFHN ALYEFTGNLVQVLVCARLFQPLKRVNPGSHRQWVSTECAGLIHWPCRSNHLHYLPPSTICTNWQTTTNNLSKSCQIRSYSEVLLSTTV* | |||
Physicochemical properties | |||
Number of amino acids: | 208 | ||
Molecular weight: | 13,171.937 | ||
Theoretical pI: | 6.080 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 8940 | ||
Instability index: | 18.749 | ||
aromaticity | 0.139 | ||
GRAVY | -0.100 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.270 | ||
sheet | 0.295 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337116.1 | complete | 122 | 518-150(-) |
Amino Acid sequence : | |||
MEMVAPAGPMYQAGTLSGNPLAMTAGIHPLKRLKQPGTYEYLDKITGELIQGIVEAGKKAGHAISGGYINGMFGFFFNDGPVYNFEDAKKSDSAKFAKFFRAMLEEGVYFAPSQFEAGFT GL* | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 13,171.937 | ||
Theoretical pI: | 6.080 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 8940 | ||
Instability index: | 18.749 | ||
aromaticity | 0.139 | ||
GRAVY | -0.100 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.270 | ||
sheet | 0.295 |