| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337122.1 | 3prime_partial | 132 | 359-754(+) |
Amino Acid sequence : | |||
| MEISVGTIDVNGFSAKHVSPDYYFVPPYVYYGRITPNAATKTKDATLPLVPEEKTAMIVFYCIPVTPGYSRLIYAGARNFAVHIDRFVPRWITHMSHNLIFDSDLFLLHVEEQKLNDLDW HKSCYIPTKADG | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 13,457.971 | ||
| Theoretical pI: | 5.832 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23045 | ||
| Instability index: | 45.023 | ||
| aromaticity | 0.110 | ||
| GRAVY | -0.728 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.280 | ||
| sheet | 0.178 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337122.1 | 5prime_partial | 118 | 2-358(+) |
Amino Acid sequence : | |||
| HEGNFIPQAPHDGPPVETSKKACVKGVYPSCVRNGIVWFWPNSDPKYKDIYLTNKPHYIPELDDPSFTCTTITREVPYGYEILAENLMDPSHVPYAHYGILELEKVKESSKRDREGGH* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 13,457.971 | ||
| Theoretical pI: | 5.832 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23045 | ||
| Instability index: | 45.023 | ||
| aromaticity | 0.110 | ||
| GRAVY | -0.728 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.280 | ||
| sheet | 0.178 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337122.1 | 3prime_partial | 132 | 359-754(+) |
Amino Acid sequence : | |||
| MEISVGTIDVNGFSAKHVSPDYYFVPPYVYYGRITPNAATKTKDATLPLVPEEKTAMIVFYCIPVTPGYSRLIYAGARNFAVHIDRFVPRWITHMSHNLIFDSDLFLLHVEEQKLNDLDW HKSCYIPTKADG | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 13,457.971 | ||
| Theoretical pI: | 5.832 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23045 | ||
| Instability index: | 45.023 | ||
| aromaticity | 0.110 | ||
| GRAVY | -0.728 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.280 | ||
| sheet | 0.178 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337122.1 | 5prime_partial | 118 | 2-358(+) |
Amino Acid sequence : | |||
| HEGNFIPQAPHDGPPVETSKKACVKGVYPSCVRNGIVWFWPNSDPKYKDIYLTNKPHYIPELDDPSFTCTTITREVPYGYEILAENLMDPSHVPYAHYGILELEKVKESSKRDREGGH* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 13,457.971 | ||
| Theoretical pI: | 5.832 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23045 | ||
| Instability index: | 45.023 | ||
| aromaticity | 0.110 | ||
| GRAVY | -0.728 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.280 | ||
| sheet | 0.178 | ||