Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337129.1	5prime_partial	229	1-690(+)
Amino Acid sequence :
SCRILHEAEPIAFPYSFKSDLYLKNHYFTQLQIFAKMTQDVEMMEQQPAASNPVSSASPSTLQNLKDMAALIEMGAYAREVRRIVRAIRWTMQIRKKRNAPGLAAFRNFALLPGSEVHSR LSSYMPKEEEYDMEVEIVTSAPSKHSLPESEIYCYLLLLIYLIDQKKYNEAKACSSAGIACMKKIDRRTVDVLASRLYFYFSLSYELTGELAAIRGTLLAFASDCYFAA*
Physicochemical properties
Number of amino acids:		229
Molecular weight:		26,032.813
Theoretical pI:		8.188
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		26360 26610
Instability index:		60.118
aromaticity		0.109
GRAVY		-0.111
Secondary Structure Fraction
Helix		0.314
turn		0.192
sheet		0.336