| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337153.1 | 5prime_partial | 229 | 1-690(+) |
Amino Acid sequence : | |||
| APPLWFRHTAILAAEMPVLGWDYPLHLGVTEAGEGEDGRMKSAIGIGTLLMDGLGDTIRVSLTEPPEEEIDPCRRLANLGMRTSELQKGVTPFEEKHRHYFDFQRRTGQLPVQKEGEEVD YRGVLHRDGSLLMSVSLDQLKAPELLYKSLAAKLVIGMPFKDLATVDSILLRELPPQEDKDARLALKRLIDVSMGVLTPLSEQLTKPLPNALALVTLKELSSGAHQLLP* | |||
Physicochemical properties | |||
| Number of amino acids: | 229 | ||
| Molecular weight: | 25,346.056 | ||
| Theoretical pI: | 5.436 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 49.858 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.181 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.214 | ||
| sheet | 0.354 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337153.1 | 5prime_partial | 229 | 1-690(+) |
Amino Acid sequence : | |||
| APPLWFRHTAILAAEMPVLGWDYPLHLGVTEAGEGEDGRMKSAIGIGTLLMDGLGDTIRVSLTEPPEEEIDPCRRLANLGMRTSELQKGVTPFEEKHRHYFDFQRRTGQLPVQKEGEEVD YRGVLHRDGSLLMSVSLDQLKAPELLYKSLAAKLVIGMPFKDLATVDSILLRELPPQEDKDARLALKRLIDVSMGVLTPLSEQLTKPLPNALALVTLKELSSGAHQLLP* | |||
Physicochemical properties | |||
| Number of amino acids: | 229 | ||
| Molecular weight: | 25,346.056 | ||
| Theoretical pI: | 5.436 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 49.858 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.181 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.214 | ||
| sheet | 0.354 | ||