| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337171.1 | internal | 137 | 1-411(+) |
Amino Acid sequence : | |||
| NAVKKGQLFRPCRRQTHCQKRPITDGSSQQRHLQGLLRRRRETIHSAAAHTPPCGVTVTQGRVPRVLPEGPVGPTDELARQIQRPRLPQRIPVQDVVVDPMGRQLGLRRPTGDPVGHAGR ARVELVRRRDPDSGGEL | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 15,025.745 | ||
| Theoretical pI: | 8.581 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
| Instability index: | 42.108 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.334 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.343 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337171.1 | internal | 137 | 2-412(+) |
Amino Acid sequence : | |||
| TPLKKDNFFDLAGGKLTVKNVPLLTEVPSNVTFRGFSGAAVKPSTAPPHILHRAASQSHKGGFLEFSQKDPSDRLTNSLGKFNGRDFLSVFRFKTWWSTQWVGNSGSDVQLETQWVMLDV PELNSYAVVIPIVEGSF | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 15,025.745 | ||
| Theoretical pI: | 8.581 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
| Instability index: | 42.108 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.334 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.343 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337171.1 | internal | 137 | 411-1(-) |
Amino Acid sequence : | |||
| KLPSTIGITTAYEFNSGTSSMTHWVSSWTSEPELPTHWVDHHVLNRNTLRKSRPLNLPSEFVSRSDGSFWENSRNPPLCDCDAARWSMCGGAVDGFTAAPEKPLKVTLLGTSVSNGTFLT VSLPPARSKKLSFFNGV | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 15,025.745 | ||
| Theoretical pI: | 8.581 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
| Instability index: | 42.108 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.334 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.343 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337171.1 | internal | 137 | 1-411(+) |
Amino Acid sequence : | |||
| NAVKKGQLFRPCRRQTHCQKRPITDGSSQQRHLQGLLRRRRETIHSAAAHTPPCGVTVTQGRVPRVLPEGPVGPTDELARQIQRPRLPQRIPVQDVVVDPMGRQLGLRRPTGDPVGHAGR ARVELVRRRDPDSGGEL | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 15,025.745 | ||
| Theoretical pI: | 8.581 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
| Instability index: | 42.108 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.334 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.343 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337171.1 | internal | 137 | 2-412(+) |
Amino Acid sequence : | |||
| TPLKKDNFFDLAGGKLTVKNVPLLTEVPSNVTFRGFSGAAVKPSTAPPHILHRAASQSHKGGFLEFSQKDPSDRLTNSLGKFNGRDFLSVFRFKTWWSTQWVGNSGSDVQLETQWVMLDV PELNSYAVVIPIVEGSF | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 15,025.745 | ||
| Theoretical pI: | 8.581 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
| Instability index: | 42.108 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.334 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.343 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337171.1 | internal | 137 | 411-1(-) |
Amino Acid sequence : | |||
| KLPSTIGITTAYEFNSGTSSMTHWVSSWTSEPELPTHWVDHHVLNRNTLRKSRPLNLPSEFVSRSDGSFWENSRNPPLCDCDAARWSMCGGAVDGFTAAPEKPLKVTLLGTSVSNGTFLT VSLPPARSKKLSFFNGV | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 15,025.745 | ||
| Theoretical pI: | 8.581 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
| Instability index: | 42.108 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.334 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.343 | ||
| sheet | 0.204 | ||