Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337171.1 | internal | 137 | 1-411(+) |
Amino Acid sequence : | |||
NAVKKGQLFRPCRRQTHCQKRPITDGSSQQRHLQGLLRRRRETIHSAAAHTPPCGVTVTQGRVPRVLPEGPVGPTDELARQIQRPRLPQRIPVQDVVVDPMGRQLGLRRPTGDPVGHAGR ARVELVRRRDPDSGGEL | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 15,025.745 | ||
Theoretical pI: | 8.581 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
Instability index: | 42.108 | ||
aromaticity | 0.095 | ||
GRAVY | -0.334 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.343 | ||
sheet | 0.204 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337171.1 | internal | 137 | 2-412(+) |
Amino Acid sequence : | |||
TPLKKDNFFDLAGGKLTVKNVPLLTEVPSNVTFRGFSGAAVKPSTAPPHILHRAASQSHKGGFLEFSQKDPSDRLTNSLGKFNGRDFLSVFRFKTWWSTQWVGNSGSDVQLETQWVMLDV PELNSYAVVIPIVEGSF | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 15,025.745 | ||
Theoretical pI: | 8.581 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
Instability index: | 42.108 | ||
aromaticity | 0.095 | ||
GRAVY | -0.334 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.343 | ||
sheet | 0.204 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337171.1 | internal | 137 | 411-1(-) |
Amino Acid sequence : | |||
KLPSTIGITTAYEFNSGTSSMTHWVSSWTSEPELPTHWVDHHVLNRNTLRKSRPLNLPSEFVSRSDGSFWENSRNPPLCDCDAARWSMCGGAVDGFTAAPEKPLKVTLLGTSVSNGTFLT VSLPPARSKKLSFFNGV | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 15,025.745 | ||
Theoretical pI: | 8.581 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
Instability index: | 42.108 | ||
aromaticity | 0.095 | ||
GRAVY | -0.334 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.343 | ||
sheet | 0.204 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337171.1 | internal | 137 | 1-411(+) |
Amino Acid sequence : | |||
NAVKKGQLFRPCRRQTHCQKRPITDGSSQQRHLQGLLRRRRETIHSAAAHTPPCGVTVTQGRVPRVLPEGPVGPTDELARQIQRPRLPQRIPVQDVVVDPMGRQLGLRRPTGDPVGHAGR ARVELVRRRDPDSGGEL | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 15,025.745 | ||
Theoretical pI: | 8.581 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
Instability index: | 42.108 | ||
aromaticity | 0.095 | ||
GRAVY | -0.334 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.343 | ||
sheet | 0.204 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337171.1 | internal | 137 | 2-412(+) |
Amino Acid sequence : | |||
TPLKKDNFFDLAGGKLTVKNVPLLTEVPSNVTFRGFSGAAVKPSTAPPHILHRAASQSHKGGFLEFSQKDPSDRLTNSLGKFNGRDFLSVFRFKTWWSTQWVGNSGSDVQLETQWVMLDV PELNSYAVVIPIVEGSF | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 15,025.745 | ||
Theoretical pI: | 8.581 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
Instability index: | 42.108 | ||
aromaticity | 0.095 | ||
GRAVY | -0.334 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.343 | ||
sheet | 0.204 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337171.1 | internal | 137 | 411-1(-) |
Amino Acid sequence : | |||
KLPSTIGITTAYEFNSGTSSMTHWVSSWTSEPELPTHWVDHHVLNRNTLRKSRPLNLPSEFVSRSDGSFWENSRNPPLCDCDAARWSMCGGAVDGFTAAPEKPLKVTLLGTSVSNGTFLT VSLPPARSKKLSFFNGV | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 15,025.745 | ||
Theoretical pI: | 8.581 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
Instability index: | 42.108 | ||
aromaticity | 0.095 | ||
GRAVY | -0.334 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.343 | ||
sheet | 0.204 |