| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337180.1 | internal | 258 | 3-776(+) |
Amino Acid sequence : | |||
| SENPMVLDVLSMSPLSGYLSQYDVVLSLDEFRVNTADEWKQKLAVLANQTPSLSFVQSSGLEHVQKSYCVPHSMIEKSIHIPFTGDETYCPNELFAFAPITCSGMSKFDDGGNRTNHHQN GGGSIHCLNAKDVIKLKKCAYDTMQVSKNNSGCLCSEDESCLMPVQLPGLGWVEITYSRLECLNLGRSSFSGNRSSNSRESDCLHTFVFVGDLISMAHSVHLTSYLPRLSMYFVAYLPDL FERFLTCAFHVSLALALL | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 28,615.308 | ||
| Theoretical pI: | 5.631 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 25035 | ||
| Instability index: | 45.886 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.034 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.279 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337180.1 | internal | 258 | 3-776(+) |
Amino Acid sequence : | |||
| SENPMVLDVLSMSPLSGYLSQYDVVLSLDEFRVNTADEWKQKLAVLANQTPSLSFVQSSGLEHVQKSYCVPHSMIEKSIHIPFTGDETYCPNELFAFAPITCSGMSKFDDGGNRTNHHQN GGGSIHCLNAKDVIKLKKCAYDTMQVSKNNSGCLCSEDESCLMPVQLPGLGWVEITYSRLECLNLGRSSFSGNRSSNSRESDCLHTFVFVGDLISMAHSVHLTSYLPRLSMYFVAYLPDL FERFLTCAFHVSLALALL | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 28,615.308 | ||
| Theoretical pI: | 5.631 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 25035 | ||
| Instability index: | 45.886 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.034 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.279 | ||
| sheet | 0.252 | ||