Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337185.1 | 3prime_partial | 208 | 95-718(+) |
Amino Acid sequence : | |||
MESAALSQIGLAGLAVMGQNLALNIAEKGFPISVFNRTASEVDETLDRAHREGQLPLTGHYTPKDFVLSLKKPRSVIILVKAGAPVDQTIAALSAYMEPGDTIIDGGNEWYENTERRMVN TAANGLLYLCMGVSGGEYGARNGPSLMPGSSHRAYLNIHNILDKIAAQVDDGPCVTYIGEGGSGNFVKMVHNGIEYGDMQLISEAYNV | |||
Physicochemical properties | |||
Number of amino acids: | 208 | ||
Molecular weight: | 22,259.987 | ||
Theoretical pI: | 5.052 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19035 | ||
Instability index: | 33.240 | ||
aromaticity | 0.067 | ||
GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
Helix | 0.293 | ||
turn | 0.284 | ||
sheet | 0.288 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337185.1 | 3prime_partial | 208 | 95-718(+) |
Amino Acid sequence : | |||
MESAALSQIGLAGLAVMGQNLALNIAEKGFPISVFNRTASEVDETLDRAHREGQLPLTGHYTPKDFVLSLKKPRSVIILVKAGAPVDQTIAALSAYMEPGDTIIDGGNEWYENTERRMVN TAANGLLYLCMGVSGGEYGARNGPSLMPGSSHRAYLNIHNILDKIAAQVDDGPCVTYIGEGGSGNFVKMVHNGIEYGDMQLISEAYNV | |||
Physicochemical properties | |||
Number of amino acids: | 208 | ||
Molecular weight: | 22,259.987 | ||
Theoretical pI: | 5.052 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19035 | ||
Instability index: | 33.240 | ||
aromaticity | 0.067 | ||
GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
Helix | 0.293 | ||
turn | 0.284 | ||
sheet | 0.288 |