| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337198.1 | 5prime_partial | 185 | 3-560(+) |
Amino Acid sequence : | |||
| TQRLYCMASMICTKTLSLGKPIFNHVSDPSEIAYKRRCSARFRMSSDQPKLEVGAEVFLLKGNQVLLGRRRTAIGYGHFALPGGHLEFGESFEECAVREVKEETGLEINGVEFLTVTSNV VLDPKPAQLIAVFMRASLVDPTQEPINLEPEKCDSWGWYDWNNLPRPLMITLETLVLRGLNPFPA* | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 20,784.778 | ||
| Theoretical pI: | 5.949 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
| Instability index: | 46.272 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.139 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.243 | ||
| sheet | 0.292 | ||