Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337198.1 | 5prime_partial | 185 | 3-560(+) |
Amino Acid sequence : | |||
TQRLYCMASMICTKTLSLGKPIFNHVSDPSEIAYKRRCSARFRMSSDQPKLEVGAEVFLLKGNQVLLGRRRTAIGYGHFALPGGHLEFGESFEECAVREVKEETGLEINGVEFLTVTSNV VLDPKPAQLIAVFMRASLVDPTQEPINLEPEKCDSWGWYDWNNLPRPLMITLETLVLRGLNPFPA* | |||
Physicochemical properties | |||
Number of amino acids: | 185 | ||
Molecular weight: | 20,784.778 | ||
Theoretical pI: | 5.949 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
Instability index: | 46.272 | ||
aromaticity | 0.086 | ||
GRAVY | -0.139 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.243 | ||
sheet | 0.292 |