| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337205.1 | internal | 233 | 1-699(+) |
Amino Acid sequence : | |||
| RTTFFFLPKKKKQNPPLSPPTMALLVEKTSSGREYKVKDMSQADFSRLEINLAEVKMPGLMSCRTKFSPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAVI SRDSAAVFAWKGETLQEYWWCTERTLDWGPGGGPDLIVNDGGDATLLIHEGVKAEEEYSNSGKLPDPSSTDNAEFQIVLTIIRDGLKENPTKYTKMNERLVGVSEETTTGVKR | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 16,420.413 | ||
| Theoretical pI: | 11.897 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 92.387 | ||
| aromaticity | 0.021 | ||
| GRAVY | -1.340 | ||
Secondary Structure Fraction | |||
| Helix | 0.199 | ||
| turn | 0.298 | ||
| sheet | 0.184 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337205.1 | 5prime_partial | 141 | 3-428(+) |
Amino Acid sequence : | |||
| HHVLLPPQEEETESPPFPSYNGAPCRENQLRPRIQGQGHVSGRLQPPRNQPRRGQDARPHVVPHQIQPLPAIQGRQDHWKPPHDHPDRRPHRNPNRARSRGPLVLLQHLLHAGPRRRRHL ARQRRRLRLERGDSPGILVVH* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 16,420.413 | ||
| Theoretical pI: | 11.897 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 92.387 | ||
| aromaticity | 0.021 | ||
| GRAVY | -1.340 | ||
Secondary Structure Fraction | |||
| Helix | 0.199 | ||
| turn | 0.298 | ||
| sheet | 0.184 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337205.1 | internal | 233 | 1-699(+) |
Amino Acid sequence : | |||
| RTTFFFLPKKKKQNPPLSPPTMALLVEKTSSGREYKVKDMSQADFSRLEINLAEVKMPGLMSCRTKFSPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAVI SRDSAAVFAWKGETLQEYWWCTERTLDWGPGGGPDLIVNDGGDATLLIHEGVKAEEEYSNSGKLPDPSSTDNAEFQIVLTIIRDGLKENPTKYTKMNERLVGVSEETTTGVKR | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 16,420.413 | ||
| Theoretical pI: | 11.897 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 92.387 | ||
| aromaticity | 0.021 | ||
| GRAVY | -1.340 | ||
Secondary Structure Fraction | |||
| Helix | 0.199 | ||
| turn | 0.298 | ||
| sheet | 0.184 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337205.1 | 5prime_partial | 141 | 3-428(+) |
Amino Acid sequence : | |||
| HHVLLPPQEEETESPPFPSYNGAPCRENQLRPRIQGQGHVSGRLQPPRNQPRRGQDARPHVVPHQIQPLPAIQGRQDHWKPPHDHPDRRPHRNPNRARSRGPLVLLQHLLHAGPRRRRHL ARQRRRLRLERGDSPGILVVH* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 16,420.413 | ||
| Theoretical pI: | 11.897 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 92.387 | ||
| aromaticity | 0.021 | ||
| GRAVY | -1.340 | ||
Secondary Structure Fraction | |||
| Helix | 0.199 | ||
| turn | 0.298 | ||
| sheet | 0.184 | ||