| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337206.1 | internal | 212 | 2-637(+) |
Amino Acid sequence : | |||
| NYSSLPFLYYALILMAESDSNTNNLQQPLLAETEEDQSLKYFEFVQVASFHALMYAAKLYSLAKENSGPLKPGVDTVEGTVKTVVGPVYSKYQGVPVHVLKFVDRKVDKTLNRVQNRVPP TLRQVSTQALEVAQKAPAAARSVVSEVKTTGLVETASGLAKSVYAKYEPAAKDLYTKYEPVAEQYASTTWRSLNQLPLFPQVAQAVAPTASY | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 23,329.261 | ||
| Theoretical pI: | 8.587 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26360 26360 | ||
| Instability index: | 39.143 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.196 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.217 | ||
| sheet | 0.292 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337206.1 | internal | 212 | 2-637(+) |
Amino Acid sequence : | |||
| NYSSLPFLYYALILMAESDSNTNNLQQPLLAETEEDQSLKYFEFVQVASFHALMYAAKLYSLAKENSGPLKPGVDTVEGTVKTVVGPVYSKYQGVPVHVLKFVDRKVDKTLNRVQNRVPP TLRQVSTQALEVAQKAPAAARSVVSEVKTTGLVETASGLAKSVYAKYEPAAKDLYTKYEPVAEQYASTTWRSLNQLPLFPQVAQAVAPTASY | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 23,329.261 | ||
| Theoretical pI: | 8.587 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26360 26360 | ||
| Instability index: | 39.143 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.196 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.217 | ||
| sheet | 0.292 | ||