| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337208.1 | internal | 143 | 1-429(+) |
Amino Acid sequence : | |||
| TLLSPSATPTSTTSSRRRNAASAAGSSSSPPRTSPPSPSSKPSEARSPTNTLRACPETATTEATSSSTRSRTSLAHVPSRPTASTPPNGASMASPTADAPLISPPTRLFSTPTTGSWALI CLPAAISRTVTTLPAGRRSVPPR | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 15,453.046 | ||
| Theoretical pI: | 6.084 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17545 | ||
| Instability index: | 41.667 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.494 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.317 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337208.1 | internal | 142 | 3-428(+) |
Amino Acid sequence : | |||
| APLSVGDPDIHDLIEKEKRRQCRGIELIASENFTSFSVLEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPSKWGVNGQPYGGCPANFAAYTAVLNPHDRIMGLDL PSGGHLTHGYYTSGGKKISATS | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,453.046 | ||
| Theoretical pI: | 6.084 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17545 | ||
| Instability index: | 41.667 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.494 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.317 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337208.1 | internal | 143 | 1-429(+) |
Amino Acid sequence : | |||
| TLLSPSATPTSTTSSRRRNAASAAGSSSSPPRTSPPSPSSKPSEARSPTNTLRACPETATTEATSSSTRSRTSLAHVPSRPTASTPPNGASMASPTADAPLISPPTRLFSTPTTGSWALI CLPAAISRTVTTLPAGRRSVPPR | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 15,453.046 | ||
| Theoretical pI: | 6.084 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17545 | ||
| Instability index: | 41.667 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.494 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.317 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337208.1 | internal | 142 | 3-428(+) |
Amino Acid sequence : | |||
| APLSVGDPDIHDLIEKEKRRQCRGIELIASENFTSFSVLEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPSKWGVNGQPYGGCPANFAAYTAVLNPHDRIMGLDL PSGGHLTHGYYTSGGKKISATS | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,453.046 | ||
| Theoretical pI: | 6.084 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17545 | ||
| Instability index: | 41.667 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.494 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.317 | ||
| sheet | 0.246 | ||