| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337210.1 | complete | 120 | 374-12(-) |
Amino Acid sequence : | |||
| MPIATNLEFIPDLSPLEQQWKQYYVPFLFVQDSNCNFGIPRCEYYFHQTQPYFPESHHCFSLFLHFSTCSDHHHYSSLARRSRGSGSRSNSYFDVRPTDDAPLTTDNCLDYWRRAHLDCC * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 12,441.149 | ||
| Theoretical pI: | 4.856 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 38.130 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.897 | ||
Secondary Structure Fraction | |||
| Helix | 0.209 | ||
| turn | 0.426 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337210.1 | complete | 115 | 2-349(+) |
Amino Acid sequence : | |||
| MGNSNSNLGAPSSNNPNSYQLSGEHHLLGVHQNMNLSGFLSRDSGVQVRSNDDDLSRWKSGETVRNNDGIPENMVEFDGNNIHSGESQNYNLNLAQKGMEHNIASTAAQVDSGLE* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,441.149 | ||
| Theoretical pI: | 4.856 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 38.130 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.897 | ||
Secondary Structure Fraction | |||
| Helix | 0.209 | ||
| turn | 0.426 | ||
| sheet | 0.226 | ||