Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337211.1 | 5prime_partial | 121 | 575-210(-) |
Amino Acid sequence : | |||
ARGIDAMGNSNSNLGASTSNNPNSYQLSGEHHLLGVHQNMNLSGFLSRDAGVQVRSNDDDLSRWKSGETVRNNDGIPENMVEFDGNNIHSGESQNYNLNLAQKGMEHNIASTAAQVDSGL E* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 14,392.813 | ||
Theoretical pI: | 6.088 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28795 | ||
Instability index: | 64.153 | ||
aromaticity | 0.175 | ||
GRAVY | -0.645 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.233 | ||
sheet | 0.150 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337211.1 | complete | 120 | 185-547(+) |
Amino Acid sequence : | |||
MPIATNLEFIPDLSPLEQQWKQYYVPFLFVQDSNCNFGIHRCEYYFHQTQPYFPESHHCFSLFLHFSTCSDHHHYSSLARRRRGSGSRSNSYFDVRPTDDAPLTTDNCLDYWRWTHLDCC * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 14,392.813 | ||
Theoretical pI: | 6.088 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28795 | ||
Instability index: | 64.153 | ||
aromaticity | 0.175 | ||
GRAVY | -0.645 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.233 | ||
sheet | 0.150 |