| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337219.1 | 5prime_partial | 184 | 1-555(+) |
Amino Acid sequence : | |||
| LNMFLKEQHALYNAATEDSKPTTDSELATDSNTVDDIGSGGEKVGENVTTDIRVERSTKNSSNSEKAELARQILLSFIVKSAHNTSDSPAVAPVTDKKNDYSSSPAEAIASDSAIIKIFY GNDEKTLAVETNDSESQKAADVNNNKTRDGEGFVLVTRRRRNRHHVTNGVNGLYSQQSICASVR* | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 19,978.552 | ||
| Theoretical pI: | 5.415 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 48.015 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.720 | ||
Secondary Structure Fraction | |||
| Helix | 0.223 | ||
| turn | 0.277 | ||
| sheet | 0.223 | ||