Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337219.1 | 5prime_partial | 184 | 1-555(+) |
Amino Acid sequence : | |||
LNMFLKEQHALYNAATEDSKPTTDSELATDSNTVDDIGSGGEKVGENVTTDIRVERSTKNSSNSEKAELARQILLSFIVKSAHNTSDSPAVAPVTDKKNDYSSSPAEAIASDSAIIKIFY GNDEKTLAVETNDSESQKAADVNNNKTRDGEGFVLVTRRRRNRHHVTNGVNGLYSQQSICASVR* | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 19,978.552 | ||
Theoretical pI: | 5.415 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 48.015 | ||
aromaticity | 0.043 | ||
GRAVY | -0.720 | ||
Secondary Structure Fraction | |||
Helix | 0.223 | ||
turn | 0.277 | ||
sheet | 0.223 |