Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337221.1 | 5prime_partial | 177 | 2-535(+) |
Amino Acid sequence : | |||
KMKILFALHPFESKHTFILLHRTLQLKSKHKFSARNVNSLDGRLLSLLLRHRHRQHPILHARLHLIHLGIIRQAEAAEELAGAPLDAVPRVVLLLLLTAALAADLEHIAFLHLNLHLLLL EGGHVRLQHVRLRRLLPVHTCRRELRRLAAGVAGEVAEWIPQVQRKWVAPAPEETRN* | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 18,890.178 | ||
Theoretical pI: | 8.965 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 48.872 | ||
aromaticity | 0.072 | ||
GRAVY | -0.764 | ||
Secondary Structure Fraction | |||
Helix | 0.247 | ||
turn | 0.211 | ||
sheet | 0.235 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337221.1 | 5prime_partial | 166 | 598-98(-) |
Amino Acid sequence : | |||
TRINTKLSSIHTKHTFKRKMSLIPSFFGRRSDPFSLDLWDPFRDFTGDTGSETSQFAATRVDWKETPEAHVLKADVPALKKEEVKVEVEEGNVLQISGECSREKEEKNDTWHRVERSSGK FLRRFRLPDNAKMDQVKASMENGVLTVTVPKEEAKKPAVKAIDISG* | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 18,890.178 | ||
Theoretical pI: | 8.965 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 48.872 | ||
aromaticity | 0.072 | ||
GRAVY | -0.764 | ||
Secondary Structure Fraction | |||
Helix | 0.247 | ||
turn | 0.211 | ||
sheet | 0.235 |