Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337222.1 | 3prime_partial | 127 | 155-535(+) |
Amino Acid sequence : | |||
MNKRSFKYTWVLDKLRAERERGITIDIALRKFETTKYYCTGIDAPGHRDFIKNMITGTSQTDCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNNMDATTPKYSKARYD EILKEVS | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 14,342.331 | ||
Theoretical pI: | 8.598 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
Instability index: | 22.931 | ||
aromaticity | 0.087 | ||
GRAVY | -0.375 | ||
Secondary Structure Fraction | |||
Helix | 0.268 | ||
turn | 0.165 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337222.1 | 3prime_partial | 127 | 155-535(+) |
Amino Acid sequence : | |||
MNKRSFKYTWVLDKLRAERERGITIDIALRKFETTKYYCTGIDAPGHRDFIKNMITGTSQTDCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNNMDATTPKYSKARYD EILKEVS | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 14,342.331 | ||
Theoretical pI: | 8.598 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
Instability index: | 22.931 | ||
aromaticity | 0.087 | ||
GRAVY | -0.375 | ||
Secondary Structure Fraction | |||
Helix | 0.268 | ||
turn | 0.165 | ||
sheet | 0.220 |