Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337234.1 | 5prime_partial | 165 | 2-499(+) |
Amino Acid sequence : | |||
ERKTSHRNNFTNRTYHTHRQISDSQEYVKNTCTHILKSKPHIKSMLNYYSSNSSKPTQCDSQGDNGRLAQSLASPTTPEKPNASGSTPPCPYGTPPQPQPSTRRAPREKHRRPPSSQSCG SKTRHTHTPAGGTRPPACHSASSTLPRYGTLSSPNYPLLSTLLRR* | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 12,499.644 | ||
Theoretical pI: | 11.707 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 62.651 | ||
aromaticity | 0.067 | ||
GRAVY | -0.186 | ||
Secondary Structure Fraction | |||
Helix | 0.352 | ||
turn | 0.162 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337234.1 | 5prime_partial | 160 | 707-225(-) |
Amino Acid sequence : | |||
PRQVADSIPFSSDKLPEIYTKFSVEPDSDEAEAMKKTIQECEEKGIKGEEKVCATSLESMVDFATSKIGINVEAVSTEADSSERKVYRIEGVSTKPSDKPVVVCHQQEYEYAVFYCHKTE TTVAYDVSLVGPGGSKAEAVAVCHRDTAEWNPKHLAFQVL* | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 12,499.644 | ||
Theoretical pI: | 11.707 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 62.651 | ||
aromaticity | 0.067 | ||
GRAVY | -0.186 | ||
Secondary Structure Fraction | |||
Helix | 0.352 | ||
turn | 0.162 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337234.1 | complete | 105 | 195-512(+) |
Amino Acid sequence : | |||
MADWHSPWLHLQHLKSQMLRVPLRRVPMAHRHSLSLRPAGPHERNIVGHRRLSLVAVKHGILILLLVAHDHRLVTRLRRHSLDTVHFPLRTIRFCRHCFDVDPYF* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 12,499.644 | ||
Theoretical pI: | 11.707 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 62.651 | ||
aromaticity | 0.067 | ||
GRAVY | -0.186 | ||
Secondary Structure Fraction | |||
Helix | 0.352 | ||
turn | 0.162 | ||
sheet | 0.248 |