| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337245.1 | complete | 137 | 499-86(-) |
Amino Acid sequence : | |||
| MAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAQWKKPEEFRPERFLEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTTEKGGQF SLHILKHSTIVLKPRSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 13,631.525 | ||
| Theoretical pI: | 6.832 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 44.317 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.235 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.230 | ||
| sheet | 0.303 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337245.1 | complete | 122 | 119-487(+) |
Amino Acid sequence : | |||
| MLQNVKTELPTFLRGINLRLPWRRQQLEVLYESAQRNTQNRQRKDNTRAAPSANAEGEVPKVIAIGLDFSLLFQESLGPELLGLFPLGRVVGQPPRIHQDLALGGDVVATELCIMEVHVG HQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,631.525 | ||
| Theoretical pI: | 6.832 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 44.317 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.235 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.230 | ||
| sheet | 0.303 | ||