Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337246.1	complete	142	41-469(+)
Amino Acid sequence :
MVLIKPQEACPTGEVYRRLRLDQTSQLDPLLLLEKISKNGISQDVCVNDLEPPAFEVVPLLKRLKQRVAAAGRGQYDAVFMSGSGSTIVGVGSPDPPQFVYDDDEYQNVFLSEAKFITRS PNQWYSEPLSTEDSICSSKNPE*
Physicochemical properties
Number of amino acids:		142
Molecular weight:		15,780.641
Theoretical pI:		4.695
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 13075
Instability index:		51.872
aromaticity		0.077
GRAVY		-0.379
Secondary Structure Fraction
Helix		0.303
turn		0.275
sheet		0.232