Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337275.1 | 5prime_partial | 129 | 1-390(+) |
Amino Acid sequence : | |||
ARGPLPNSARGGPDAGSMTFSVRVRRRLPEFVNSVNLKYVKLGYHYLINHGIYLATIPVLVLVFRAEVGSLNREELWRTIWDPTAGYDLATVLAFLALFVFLSPFTSCRAGVIFILLILL ATNPLMISR* | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 12,387.901 | ||
Theoretical pI: | 6.295 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 43.165 | ||
aromaticity | 0.091 | ||
GRAVY | -0.474 | ||
Secondary Structure Fraction | |||
Helix | 0.282 | ||
turn | 0.227 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337275.1 | 3prime_partial | 111 | 321-653(+) |
Amino Acid sequence : | |||
MSRGRNIYLADFACYKPTDDFKVTKDEFIDLARKSGKFDESSLEFQRRILESSGLGDETYVPKSIGSPDNTATMKERRAEASSVIFRALDELFXKTPIRPKDVGVLVVNCS | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,387.901 | ||
Theoretical pI: | 6.295 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 43.165 | ||
aromaticity | 0.091 | ||
GRAVY | -0.474 | ||
Secondary Structure Fraction | |||
Helix | 0.282 | ||
turn | 0.227 | ||
sheet | 0.227 |