| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337275.1 | 5prime_partial | 129 | 1-390(+) |
Amino Acid sequence : | |||
| ARGPLPNSARGGPDAGSMTFSVRVRRRLPEFVNSVNLKYVKLGYHYLINHGIYLATIPVLVLVFRAEVGSLNREELWRTIWDPTAGYDLATVLAFLALFVFLSPFTSCRAGVIFILLILL ATNPLMISR* | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 12,387.901 | ||
| Theoretical pI: | 6.295 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 43.165 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.474 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.227 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337275.1 | 3prime_partial | 111 | 321-653(+) |
Amino Acid sequence : | |||
| MSRGRNIYLADFACYKPTDDFKVTKDEFIDLARKSGKFDESSLEFQRRILESSGLGDETYVPKSIGSPDNTATMKERRAEASSVIFRALDELFXKTPIRPKDVGVLVVNCS | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,387.901 | ||
| Theoretical pI: | 6.295 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 43.165 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.474 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.227 | ||
| sheet | 0.227 | ||