| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337286.1 | 3prime_partial | 201 | 121-723(+) |
Amino Acid sequence : | |||
| MALKLCVTPCKMPSFPGSQLRSHRVSMASTIHSPSIDAGKVKKPFSPPREVHVQVTHPLPPEKREIFNSLQDWAEENILVLLKPVEKCWQPSDFLPEPSSEGFEEQVRELRKRAKELPDD YLVVLVGDMITEEALPTYQTMLNTLDGGVRDETGASLTPWAIWTRAWTAEENRHGDLLNKYLYLTGRVDMRQIEKTIQYLI | |||
Physicochemical properties | |||
| Number of amino acids: | 201 | ||
| Molecular weight: | 22,983.144 | ||
| Theoretical pI: | 5.780 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 35075 | ||
| Instability index: | 54.575 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.437 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.219 | ||
| sheet | 0.279 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337286.1 | 3prime_partial | 201 | 121-723(+) |
Amino Acid sequence : | |||
| MALKLCVTPCKMPSFPGSQLRSHRVSMASTIHSPSIDAGKVKKPFSPPREVHVQVTHPLPPEKREIFNSLQDWAEENILVLLKPVEKCWQPSDFLPEPSSEGFEEQVRELRKRAKELPDD YLVVLVGDMITEEALPTYQTMLNTLDGGVRDETGASLTPWAIWTRAWTAEENRHGDLLNKYLYLTGRVDMRQIEKTIQYLI | |||
Physicochemical properties | |||
| Number of amino acids: | 201 | ||
| Molecular weight: | 22,983.144 | ||
| Theoretical pI: | 5.780 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 35075 | ||
| Instability index: | 54.575 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.437 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.219 | ||
| sheet | 0.279 | ||