Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337287.1	5prime_partial	220	815-153(-)
Amino Acid sequence :
NRHGDLLNKYLYLTGRVDMRQIEKTIQYLIGSGMDPGTDKNPYLGFIYTSFQERATFVSHGNTARLAKEHGDVKLAQICGIIAADEKRHETAYTKIVEKLFEIDPDGTVLALEDMMRKKI SMPAHLMYDGADDNLFEHFSAVAQRLGVYTAKDYADILEFLVARWEVEKLTGLSGEGRKAQDYVCGLPARIRRLEERAQARAKQAAPMSFSWIHGREVML*
Physicochemical properties
Number of amino acids:		220
Molecular weight:		20,464.467
Theoretical pI:		6.397
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15970
Instability index:		52.619
aromaticity		0.066
GRAVY		0.016
Secondary Structure Fraction
Helix		0.352
turn		0.214
sheet		0.264

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337287.1	complete	182	174-722(+)
Amino Acid sequence :
MNPAEGHRRRLLRTCLRSLFQPPNPSRQTAHVVLRLTPLPRQPRQLLHLPPRHQKLEDIGVVLGGVNSEPLCYGGEVFEEVVVCTVVHQVGRHRYLLPHHVFESEHCAVWVDLEQLLDDF GVGGFVALLVCCDDAADLGKLHVTVFLGQPSCVSMRYESRPLLEGGVNESEIRVFICAWIHA*
Physicochemical properties
Number of amino acids:		182
Molecular weight:		20,464.467
Theoretical pI:		6.397
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15970
Instability index:		52.619
aromaticity		0.066
GRAVY		0.016
Secondary Structure Fraction
Helix		0.352
turn		0.214
sheet		0.264