| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337288.1 | internal | 242 | 3-728(+) |
Amino Acid sequence : | |||
| ISTMANNTNAWVITCKAAVAWKPSEPLVVEEICVEPPKSTEVRIKMLAASMCHTDILLWKGFPLPLYPRIPGHEGAGVIESVGEKVTNLKVGDTVMPLSIGECGECSNCATGKTNICFKY PPGIAGLMPDGTSRMSAKGQKLYHMFSCSTWSEYTVVDSNFVVKVDPRIPLPHASLLTCGFMTGYGAPWRESRVEKGSTVAVIGLGAVGLGAVSASRILGASKIIGIDVNELKRDKARVF GV | |||
Physicochemical properties | |||
| Number of amino acids: | 242 | ||
| Molecular weight: | 12,397.170 | ||
| Theoretical pI: | 8.052 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 43.365 | ||
| aromaticity | 0.095 | ||
| GRAVY | 0.371 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.293 | ||
| sheet | 0.207 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337288.1 | 3prime_partial | 116 | 349-2(-) |
Amino Acid sequence : | |||
| MFVFPVAQFEHSPHSPMESGITVSPTLRFVTFSPTLSITPAPSCPGIRGYRGRGKPFQSRISVWHMLAASILILTSVDLGGSTQISSTTSGSDGFHATAALHVMTQAFVLFAMVDI | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 12,397.170 | ||
| Theoretical pI: | 8.052 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 43.365 | ||
| aromaticity | 0.095 | ||
| GRAVY | 0.371 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.293 | ||
| sheet | 0.207 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337288.1 | internal | 242 | 3-728(+) |
Amino Acid sequence : | |||
| ISTMANNTNAWVITCKAAVAWKPSEPLVVEEICVEPPKSTEVRIKMLAASMCHTDILLWKGFPLPLYPRIPGHEGAGVIESVGEKVTNLKVGDTVMPLSIGECGECSNCATGKTNICFKY PPGIAGLMPDGTSRMSAKGQKLYHMFSCSTWSEYTVVDSNFVVKVDPRIPLPHASLLTCGFMTGYGAPWRESRVEKGSTVAVIGLGAVGLGAVSASRILGASKIIGIDVNELKRDKARVF GV | |||
Physicochemical properties | |||
| Number of amino acids: | 242 | ||
| Molecular weight: | 12,397.170 | ||
| Theoretical pI: | 8.052 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 43.365 | ||
| aromaticity | 0.095 | ||
| GRAVY | 0.371 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.293 | ||
| sheet | 0.207 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337288.1 | 3prime_partial | 116 | 349-2(-) |
Amino Acid sequence : | |||
| MFVFPVAQFEHSPHSPMESGITVSPTLRFVTFSPTLSITPAPSCPGIRGYRGRGKPFQSRISVWHMLAASILILTSVDLGGSTQISSTTSGSDGFHATAALHVMTQAFVLFAMVDI | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 12,397.170 | ||
| Theoretical pI: | 8.052 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 43.365 | ||
| aromaticity | 0.095 | ||
| GRAVY | 0.371 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.293 | ||
| sheet | 0.207 | ||