Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337328.1 | 5prime_partial | 154 | 1-465(+) |
Amino Acid sequence : | |||
VVFTPFFPQFYTHHTATASDFITMSWQSYIDDHLMADVDGNHLTSSAIIGHDGSVWAQSSTFPQLKPDEVTKIMNDFENPGSLAPTGLYIGGTKYMVIQGEPGAVIRGKKGSGGVTVKKT NQALIIGIYDEPMTPGQCNMVVERIGDYLFDQGL* | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 16,790.784 | ||
Theoretical pI: | 4.957 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 25.412 | ||
aromaticity | 0.104 | ||
GRAVY | -0.132 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.266 | ||
sheet | 0.175 |